Part of the ABC transporter FtsEX involved in sporulation. May act as an importer, possibly at the top of a hierarchical cascade leading to the correct temporal initiation of sporulation. Acts upstream of the histidine kinases KinA, KinB and KinC, the RapA phosphatase and the Spo0A sporulation protein. FTSE_BACSU 228 Cell division ATP-binding protein FtsE MIEMKEVYKAYPNGVKALNGISVTIHPGEFVYVVGPSGAGKSTFIKMIYREEKPTKGQILINHKDLATIKEKEIPFVRRKIGVVFQDFKLLPKLTVFENVAFALEVIGEQPSVIKKRVLEVLDLVQLKHKARQFPDQLSGGEQQRVSIARSIVNNPDVVIADEPTGNLDPDTSWEVMKTLEEINNRGTTVVMATHNKEIVNTMKKRVIAIEDGIIVRDESRGEYGSYD BSU35260 ftsE